HPA020406

RSBN1L antibody from Atlas Antibodies
FLJ42526, FLJ45813, MGC71764
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA020406
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA020406, RRID:AB_1856488
Product name
Anti-RSBN1L
Provider product page
Atlas Antibodies - HPA020406
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIK
DYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNN
LKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSH
LS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -