PAB21293

RSBN1L antibody from Abnova Corporation
FLJ42526, FLJ45813, MGC71764

Antibody data

Product number
PAB21293
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21293, RRID:AB_10962893
Product name
RSBN1L polyclonal antibody
Provider product page
Abnova Corporation - PAB21293
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RSBN1L.
Antigen sequence
KRPKMYSKSIQTICSGLLTDVEDQAAKGILNDNIK
DYVGKNLDTKNYDSKIPENSEFPFVSLKEPRVQNN
LKRLDTLEFKQLIHIEHQPNGGASVIHAYSNELSH
LS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -