HPA020413

RSBN1L antibody from Sigma-Aldrich
FLJ42526, FLJ45813, MGC71764
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020413
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020413, RRID:AB_2253910
Product name
Anti-RSBN1L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020413
Antibody type
Polyclonal
Antigen
Round spermatid basic protein 1-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTATHETGTSSDSTSSVLGPHTDNMICAVSKASLD
SVFSDKLHSKYELQQIKHEPIASVRIKEEPVNVNI
PEKTTALNNMDGKNVKAKLDHVQFAEFKIDMDSKF
ENSNKDLKEELCPGNLSLVDTR
Storage
-20C
Provider Type Product Number
- No reagents -