Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501752 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Leucine-Zipper-Like Transcription Regulator 1 (LZTR1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-LZTR1 antibody: synthetic peptide directed towards the N terminal of human LZTR1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
AGPGSTGGQIGAAALAGGARSKVAPSVDFDHSCSD
SVEYL TLNFGPFETV- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The BTB-kelch protein LZTR-1 is a novel Golgi protein that is degraded upon induction of apoptosis.
Nacak TG, Leptien K, Fellner D, Augustin HG, Kroll J
The Journal of biological chemistry 2006 Feb 24;281(8):5065-71
The Journal of biological chemistry 2006 Feb 24;281(8):5065-71
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting