HPA003203

ZNF764 antibody from MilliporeSigma / Merck KGaA
MGC13138
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003203
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF764 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA003203
Antibody type
Polyclonal
Antigen
Zinc finger protein 764 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VYFCREEWGCLRPAQRALYRDVMRETYGHLSALGI
GGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTD
PDSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQ
APSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQ
RH
Storage
-20C