H00055612-B01P

FERMT1 antibody from Abnova Corporation
C20orf42, FLJ20116, KIND1, UNC112A, URP1

Antibody data

Product number
H00055612-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055612-B01P, RRID:AB_1137857
Product name
C20orf42 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00055612-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C20orf42 protein.
Antigen sequence
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSG
DLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWL
LKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLK
MVRLRVSFSAVVFKAVSDICKILNIRRSEELSLLK
PSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASG
SSVSPGLYSKTMTPIYDPINGTPASSTMTWFSDSP
LTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAK
LNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDL
NPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIF
AALQYHISKLSLSAETQDFAGESEVDEIEAALSNL
EVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLL
PKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRC
DHENQYAQWMAACMLASKGKTMADSSYQPEVLNIL
SFLRMKNRNSASQVASSLENMDMNPECFVSPRCAK
KHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQ
SLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDA
ATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVF
TAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLD
EDLFHKLTGGQD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -