H00055612-D01

FERMT1 antibody from Abnova Corporation
C20orf42, FLJ20116, KIND1, UNC112A, URP1

Antibody data

Product number
H00055612-D01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055612-D01, RRID:AB_10615899
Product name
FERMT1 MaxPab rabbit polyclonal antibody (D01)
Provider product page
Abnova Corporation - H00055612-D01
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human FERMT1 protein.
Antigen sequence
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSG
DLHVGGVMLKLVEQINISQDWSDFALWWEQKHCWL
LKTHWTLDKYGVQADAKLLFTPQHKMLRLRLPNLK
MVRLRVSFSAVVFKAVSDICKILNIRRSEELSLLK
PSGDYFKKKKKKDKNNKEPIIEDILNLESSPTASG
SSVSPGLYSKTMTPIYDPINGTPASSTMTWFSDSP
LTEQNCSILAFSQPPQSPEALADMYQPRSLVDKAK
LNAGWLDSSRSLMEQGIQEDEQLLLRFKYYSFFDL
NPKYDAVRINQLYEQARWAILLEEIDCTEEEMLIF
AALQYHISKLSLSAETQDFAGESEVDEIEAALSNL
EVTLEGGKADSLLEDITDIPKLADNLKLFRPKKLL
PKAFKQYWFIFKDTSIAYFKNKELEQGEPLEKLNL
RGCEVVPDVNVAGRKFGIKLLIPVADGMNEMYLRC
DHENQYAQWMAACMLASKGKTMADSSYQPEVLNIL
SFLRMKNRNSASQVASSLENMDMNPECFVSPRCAK
KHKSKQLAARILEAHQNVAQMPLVEAKLRFIQAWQ
SLPEFGLTYYLVRFKGSKKDDILGVSYNRLIKIDA
ATGIPVTTWRFTNIKQWNVNWETRQVVIEFDQNVF
TAFTCLSADCKIVHEYIGGYIFLSTRSKDQNETLD
EDLFHKLTGGQD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -