ABIN405473

FERMT1 antibody from antibodies-online
C20orf42, FLJ20116, KIND1, UNC112A, URP1

Antibody data

Product number
ABIN405473
Provider
antibodies-online
Product name
anti-Fermitin Family Member 1 (FERMT1) antibody
Provider product page
antibodies-online - ABIN405473
Antibody type
Polyclonal
Antigen
The immunogen for anti-FERMT1 antibody: synthetic peptide directed towards the N terminal of human FERMT1
Reactivity
Human, Rat
Host
Rabbit
Antigen sequence
LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGD
LHVGG VMLKLVEQIN
Vial size
50 µg
Provider Type Product Number
- No reagents -