SAB2100810

FERMT1 antibody from Sigma-Aldrich
C20orf42, FLJ20116, KIND1, UNC112A, URP1
No application information provided.

Antibody data

Product number
SAB2100810
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2100810, RRID:AB_10605608
Product name
Anti-FERMT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2100810
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_060141.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MLSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSG
DLHVGGVMLKLVEQI
Storage
-20C
Provider Type Product Number
- No reagents -