HPA026878

FAT3 antibody from Sigma-Aldrich
CDHF15, CDHR10, KIAA1989
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026878
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026878, RRID:AB_1848430
Product name
Anti-FAT3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026878
Antibody type
Polyclonal
Antigen
Protocadherin Fat 3 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLDSVILNNNELPLQNKRSSFAEVVGLTELKLGCV
LYPDACKRSPCQHGGSCTGLPSGGYQCTCLSQFTG
RNCESEITACFPNPCRNGGSCDPIGNTFICNCKAG
LTG
Storage
-20C
Provider Type Product Number
- No reagents -