Antibody data

Product number
ABIN311287
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 780B (ZNF780B) (N-Term) antibody
Provider product page
antibodies-online - ABIN311287
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF780B antibody: synthetic peptide directed towards the N terminal of human ZNF780B
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
RWYPDLESKYGPEKISPENDIFEINLPKHVIKQIS
KTLGL EAFYFRNDSE
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -