HPA003311

ZNF780B antibody from Atlas Antibodies
ZNF779
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003311
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003311, RRID:AB_889141
Product name
Anti-ZNF780B
Provider product page
Atlas Antibodies - HPA003311
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHLISLGSSISKPDVITLLEQEKEPWIVVSKETSR
WYPDLESKYGPEKISPENDIFEINLPKHVIKQISK
TLGLEAFYFRNDSEYRSRFEGRQGHQEGYINQKII
SYEEMPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -