HPA003311

ZNF780B antibody from Atlas Antibodies
ZNF779
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003311
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003311, RRID:AB_1080757
Product name
Anti-ZNF780B
Provider product page
Atlas Antibodies - HPA003311
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SHLISLGSSISKPDVITLLEQEKEPWIVVSKETSR
WYPDLESKYGPEKISPENDIFEINLPKHVIKQISK
TLGLEAFYFRNDSEYRSRFEGRQGHQEGYINQKII
SYEEMPA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -