HPA003311

ZNF780B antibody from Sigma-Aldrich
ZNF779
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003311
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003311, RRID:AB_1080757
Product name
Anti-ZNF780B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003311
Antibody type
Polyclonal
Antigen
Zinc finger protein 780B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLISLGSSISKPDVITLLEQEKEPWIVVSKETSR
WYPDLESKYGPEKISPENDIFEINLPKHVIKQISK
TLGLEAFYFRNDSEYRSRFEGRQGHQEGYINQKII
SYEEMPA
Storage
-20C
Provider Type Product Number
- No reagents -