HPA026921

PIGP antibody from Sigma-Aldrich
DCRC, DSCR5, DSRC
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026921
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026921, RRID:AB_1847874
Product name
Anti-PIGP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026921
Antibody type
Polyclonal
Antigen
Phosphatidylinositol N-acetylglucosaminyltransferase subunit P recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPAL
RDISISEVNQMFFLAAKELYTK
Storage
-20C
Provider Type Product Number
- No reagents -