HPA023804

MSRA antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023804
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023804, RRID:AB_1853826
Product name
Anti-MSRA antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023804
Antibody type
Polyclonal
Antigen
Peptide methionine sulfoxide reductase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPF
PEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
Storage
-20C
Provider Type Product Number
- No reagents -