H00010224-B01P

ZNF443 antibody from Abnova Corporation
ZK1
No application information provided.

Antibody data

Product number
H00010224-B01P
Provider
Abnova Corporation
Product name
ZNF443 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00010224-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF443 protein.
Antigen sequence
MASVALEDVAVNFTREEWALLGPCQKNLYKDVMQE
TIRNLDCVVMKWKDQNIEDQYRYPRKNLRCRMLER
FIESKDGTQCGETSSQIQDSIVTKNTLPGVGPCES
SMRGEKVMGHSSLNCYIRVGAGHKPHEYHECGEKP
DTHKQRGKAFSYHNSFQTHERLHTGKKPYDCKECG
KSFSSLGNLQRHMAVQRGDGPYKCKLCGKAFFWPS
LLHMHERTHTGEKPYECKQCSKAFSFYSSYLRHER
THTGEKPYECKQCSKAFPFYSSYLRHERTHTGEKP
YKCKQCSKAFPDSSSCLIHERTHTGEKPYTCKQCG
KAFSVSGSLQRHETTHSAEKPYACQQCGKAFHHLG
SFQRHMIRHTGNGPHKCKICGKGFDCPSSLQSHER
THTGEKPYECKQCGKALSHRSSFRSHMIMHTGDGP
HKCKVCGKAFVYPSVFQRHERTHTAEKPYKCKQCG
KAYRISSSLRRHETTHTGEKPYKCTLGKAFIDFCS
FQNHKTTHTGEKPYECKECGKAFSRFRYLSRHKRT
HTGEKPYECKTCRKAFGHYDNLKVHERIHSGEKPY
ECKECGKAFSWLTCFLRHERIHMREKSYECPQCGK
AFTHSRFLQGHEKTHTGENPYECKECGKAFASLSS
LHRHKKTHWKKTHTGENPYECKECGKAFASLSSLH
RHKKTH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.