Antibody data

Product number
PAB20171
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20171, RRID:AB_10983599
Product name
ZNF443 polyclonal antibody
Provider product page
Abnova Corporation - PAB20171
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF443.
Antigen sequence
VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIR
NLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVE
SKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMR
GEKVMGHSSLNCYIRVGA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.