HPA003150

ZNF443 antibody from Atlas Antibodies
ZK1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003150
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003150, RRID:AB_1080725
Product name
Anti-ZNF443
Provider product page
Atlas Antibodies - HPA003150
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIR
NLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVE
SKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMR
GEKVMGHSSLNCYIRVGA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -