HPA003150

ZNF443 antibody from Sigma-Aldrich
ZK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003150
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003150, RRID:AB_1080725
Product name
Anti-ZNF443 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003150
Antibody type
Polyclonal
Antigen
Zinc finger protein 443 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VALEDVAVNFTREEWALLGPCQKNLYKDVMQETIR
NLDCVVMKWKDQNIEDQYRYPRKNLRCRMLERFVE
SKDGTQCGETSSQIQDSIVTKNTLPGVGPCESSMR
GEKVMGHSSLNCYIRVGA
Storage
-20C
Provider Type Product Number
- No reagents -