HPA004086

ZNF222 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004086
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004086, RRID:AB_2273259
Product name
Anti-ZNF222 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004086
Antibody type
Polyclonal
Antigen
Zinc finger protein 222 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQRKLYRDVMLENFRNLLSVGGKIQTEMETFPEAG
THEEFSCKQIWEQIASDLTRSQDTTISNSQLFEQD
DNPSQIKARLSTVHTREKPFQGENCKQFFSDVSFF
DLPQ
Storage
-20C
Provider Type Product Number
- No reagents -