HPA027977

PRSS55 antibody from Sigma-Aldrich
CT153, T-SP1, UNQ9391
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027977
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027977, RRID:AB_1858634
Product name
Anti-UNQ9391 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027977
Antibody type
Polyclonal
Antigen
Probable serine protease UNQ9391/PRO34284 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YSEELFPEELSVVLGTNDLTSPSMEIKEVASIILH
KDFKRANMDNDIALLLLASPIKLDDLKVP
Storage
-20C
Provider Type Product Number
- No reagents -