Antibody data

Product number
PAB28745
Provider
Abnova Corporation
Product name
ZNF558 polyclonal antibody
Provider product page
Abnova Corporation - PAB28745
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF558.
Antigen sequence
GELVNELLTSWLRGLVTFEDVAVEFTQEEWALLDP
AQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQ
DKKVVTEERGILPSTCPDLETLLKAKWLTPKKNVF
RKEQSKGVKTERSHRG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.