ABIN501349

ZNF558 antibody from antibodies-online
FLJ30932
Western blot
Data presented on provider website

Antibody data

Product number
ABIN501349
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 558 (ZNF558) (N-Term) antibody
Provider product page
antibodies-online - ABIN501349
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF558 antibody: synthetic peptide directed towards the N terminal of human ZNF558
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
GILPSTCPDLETLLKAKWLTPKKNVFRKEQSKGVK
TERSH RGVKLNECNQ
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.