HPA003151

ZNF558 antibody from Sigma-Aldrich
FLJ30932
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003151
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003151, RRID:AB_1859344
Product name
Anti-ZNF558 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003151
Antibody type
Polyclonal
Antigen
Zinc finger protein 558 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GELVNELLTSWLRGLVTFEDVAVEFTQEEWALLDP
AQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQ
DKKVVTEERGILPSTCPDLETLLKAKWLTPKKNVF
RKEQSKGVKTERSHRG
Storage
-20C
Provider Type Product Number
- No reagents -