HPA003151

ZNF558 antibody from MilliporeSigma / Merck KGaA
FLJ30932
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003151
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF558 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA003151
Antibody type
Polyclonal
Antigen
Zinc finger protein 558 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GELVNELLTSWLRGLVTFEDVAVEFTQEEWALLDP
AQRTLYRDVMLENCRNLASLGCRVNKPSLISQLEQ
DKKVVTEERGILPSTCPDLETLLKAKWLTPKKNVF
RKEQSKGVKTERSHRG
Storage
-20C