HPA019254

SLBP antibody from Sigma-Aldrich
HBP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019254
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019254, RRID:AB_1856951
Product name
Anti-SLBP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019254
Antibody type
Polyclonal
Antigen
Histone RNA hairpin-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CDGDASFTTPEGPKPRSRCSDWASAVEEDEMRTRV
NKEMARYKRKLLINDFGRERKSSSGSSDSKESMST
VPADFETDESVLMRRQKQINYGKNTI
Storage
-20C
Provider Type Product Number
- No reagents -