HPA064769

XKR6 antibody from Atlas Antibodies
C8orf21, C8orf5, C8orf7

Antibody data

Product number
HPA064769
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA064769, RRID:AB_2732720
Product name
Anti-XKR6
Provider product page
Atlas Antibodies - HPA064769
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FVDRRLRRTINILQYVTPTAVGIRYRDGPLLYELL
QYESSL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.