HPA024828

XKR6 antibody from MilliporeSigma / Merck KGaA
C8orf21, C8orf5, C8orf7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024828
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-XKR6 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA024828
Antibody type
Polyclonal
Antigen
XK-related protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YGVLHPTGPRAKILASSCCAELLWGIPLPPDVEPM
APEIPGYRGTQVTPTRAVTEQQEDLTADTCLPVFQ
VRPMGPPTPLGRPYLPEGPLIKIDMPR
Storage
-20C