HPA004705

ZNF75D antibody from Sigma-Aldrich
D8C6, ZKSCAN24, ZNF75, ZNF82, ZSCAN28
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004705
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004705, RRID:AB_1080749
Product name
Anti-ZNF75D antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004705
Antibody type
Polyclonal
Antigen
Zinc finger protein 75 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ETVISLGLKLKNDTGNDHPISVSTSEIQTSGCEVS
KKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKR
KKPATCKQELPKLMDLHGKGPTGEKP
Storage
-20C
Provider Type Product Number
- No reagents -