HPA014701

ZNF599 antibody from Sigma-Aldrich
FLJ30663
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014701
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014701, RRID:AB_1859371
Product name
Anti-ZNF599 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014701
Antibody type
Polyclonal
Antigen
Zinc finger protein 599 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETC
RLLVSLGHPVPKPELIYLLEHGQELWTVKRGLSQS
TCAGEKAKPKITEPTASQLAFSEESSFQELLAQRS
SRDSRLGQARDEEKLIKIQEGNLRPGTNPHKEICP
EKLSYKHDDLEPDDSLGLRVLQERVTPQDALHECD
SQGPGKDP
Storage
-20C
Provider Type Product Number
- No reagents -