HPA014701

ZNF599 antibody from Atlas Antibodies
FLJ30663
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014701
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014701, RRID:AB_1859371
Product name
Anti-ZNF599
Provider product page
Atlas Antibodies - HPA014701
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETC
RLLVSLGHPVPKPELIYLLEHGQELWTVKRGLSQS
TCAGEKAKPKITEPTASQLAFSEESSFQELLAQRS
SRDSRLGQARDEEKLIKIQEGNLRPGTNPHKEICP
EKLSYKHDDLEPDDSLGLRVLQERVTPQDALHECD
SQGPGKDP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -