Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005634-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005634-A01, RRID:AB_463662
- Product name
- PRPS2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PRPS2.
- Antigen sequence
AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHK
ERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTI
CHAADKLLSAGATKVYAILTHGIFSGPAISRINNA
AFEAV- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells.
Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells.
Mannava S, Grachtchouk V, Wheeler LJ, Im M, Zhuang D, Slavina EG, Mathews CK, Shewach DS, Nikiforov MA
Cell cycle (Georgetown, Tex.) 2008 Aug;7(15):2392-400
Cell cycle (Georgetown, Tex.) 2008 Aug;7(15):2392-400
Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells.
Mannava S, Grachtchouk V, Wheeler LJ, Im M, Zhuang D, Slavina EG, Mathews CK, Shewach DS, Nikiforov MA
Cell cycle (Georgetown, Tex.) 2008 Aug;7(15):2392-400
Cell cycle (Georgetown, Tex.) 2008 Aug;7(15):2392-400
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- PRPS2 polyclonal antibody (A01), Lot # 051212JC01. Western Blot analysis of PRPS2 expression in Daoy.