Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310167 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the N terminal of human PRPS2
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKF
SNQET SVEIGESVRG- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Partial reconstitution of mammalian phosphoribosylpyrophosphate synthetase in Escherichia coli cells. Coexpression of catalytic subunits with the 39-kDa associated protein leads to formation of soluble multimeric complexes of various compositions.
Ishijima S, Asai T, Kita K, Sonoda T, Tatibana M
Biochimica et biophysica acta 1997 Sep 26;1342(1):28-36
Biochimica et biophysica acta 1997 Sep 26;1342(1):28-36
No comments: Submit comment
No validations: Submit validation data