Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA005781 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA005781, RRID:AB_1857724
- Product name
- Anti-TACC3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSV
LRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRIL
SPSMASKLEAPFTQDDTLGLENSHPVWTQKEN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Regulating the ARNT/TACC3 axis: multiple approaches to manipulating protein/protein interactions with small molecules.
Guo Y, Partch CL, Key J, Card PB, Pashkov V, Patel A, Bruick RK, Wurdak H, Gardner KH
ACS chemical biology 2013 Mar 15;8(3):626-35
ACS chemical biology 2013 Mar 15;8(3):626-35
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-TACC3 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear and cytoplasmic positivity in epidermal cells.
- Sample type
- HUMAN