HPA005781

TACC3 antibody from Sigma-Aldrich
ERIC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005781
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005781, RRID:AB_1857724
Product name
Anti-TACC3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005781
Antibody type
Polyclonal
Antigen
Transforming acidic coiled-coil-containing protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MSLQVLNDKNVSNEKNTENCDFLFSPPEVTGRSSV
LRVSQKENVPPKNLAKAMKVTFQTPLRDPQTHRIL
SPSMASKLEAPFTQDDTLGLENSHPVWTQKEN
Storage
-20C
Provider Type Product Number
- No reagents -