HPA000943

TRMT5 antibody from Sigma-Aldrich
KIAA1393, TRM5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000943
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000943, RRID:AB_1080388
Product name
Anti-TRMT5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000943
Antibody type
Polyclonal
Antigen
tRNA-(guanine-N1) methyltransferase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGKDFLQGPVKEELMQLLGLSKERKPSVHVVMNLP
AKAIEFLSAFKWLLDGQPCSSEFLPIVHCYSFSKD
ANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNK
EMLCITFQIPASVLYKNQTRNPENHEDPPLKR
Storage
-20C
Provider Type Product Number
- No reagents -