Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Flow cytometry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN148228 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Toll-Like Receptor 7 (TLR7) antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: LKLEELDISKNSLSFLPSGVFDGMPPNLKNLSLAKNGLKSFSWKKLQCLKN conjugated to KLH, corresponding to amino acids 650-700 of Human TLR7.
- Description
- Protein G affinity purified
- Reactivity
- Human
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 50 μg
- Concentration
- 0.5 mg/ml
- Storage
- 4°C
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Flow cytometry