HPA023915

FAM167A antibody from Sigma-Aldrich
C8orf13
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023915
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023915, RRID:AB_1845768
Product name
Anti-C8orf13 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023915
Antibody type
Polyclonal
Antigen
UPF0484 protein FAM167A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LRGDINKLKIEHTCRLHRRMLNDATYELEERDELA
DLFCDSPLASSFSLSTPLKLIGVTKMNINSRRFS
Storage
-20C
Provider Type Product Number
- No reagents -