Antibody data

Product number
ABIN503312
Provider
antibodies-online
Product name
anti-CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2) antibody
Provider product page
antibodies-online - ABIN503312
Antibody type
Polyclonal
Antigen
The immunogen for anti-CTDSP2 antibody: synthetic peptide directed towards the middle region of human CTDSP2
Reactivity
Human
Host
Rabbit
Antigen sequence
ASYIFHPENAVPVQSWFDDMADTELLNLIPIFEEL
SGAED VYTSLGQLRA
Vial size
50 µg
Provider Type Product Number
- No reagents -