Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007114-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007114-M03, RRID:AB_11189999
- Product name
- TMSB4X monoclonal antibody (M03), clone 4H7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TMSB4X.
- Antigen sequence
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETI
EQEKQAGES- Isotype
- IgG
- Antibody clone number
- 4H7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Molecular anatomy of ascending aorta in atherosclerosis by MS Imaging: Specific lipid and protein patterns reflect pathology.
Martin-Lorenzo M, Balluff B, Maroto AS, Carreira RJ, van Zeijl RJ, Gonzalez-Calero L, de la Cuesta F, Barderas MG, Lopez-Almodovar LF, Padial LR, McDonnell LA, Vivanco F, Alvarez-Llamas G
Journal of proteomics 2015 Aug 3;126:245-51
Journal of proteomics 2015 Aug 3;126:245-51
No comments: Submit comment
No validations: Submit validation data