Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- GTX14334 - Provider product page
- Provider
- GeneTex
- Proper citation
- GeneTex Cat#GTX14334, RRID:AB_370625
- Product name
- Thymosin beta 4 antibody
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES conjugated to KLH, corresponding to amino acids 1-43 of Human Thymosin beta 4.
- Reactivity
- Rat, Bovine
- Host
- Rabbit
- Isotype
- IgY
- Vial size
- 50µg
- Storage
- Keep as concentrated solution. Store at 4ºC short term. For extended storage aliquot and store at -20ºC or below. Avoid freeze-thaw cycles.
No comments: Submit comment
No validations: Submit validation data