Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001886 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001886, RRID:AB_1079132
- Product name
- Anti-IL12A
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLH
HSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDI
TKDKTSTVEACLPLELTKNESCLNSRETSFITNGS
CLASRKTSFMMALCLSSIYEDLKMYQVEF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The immunophenotype of decidual macrophages in acute atherosis
IL35 Hinders Endogenous Antitumor T-cell Immunity and Responsiveness to Immunotherapy in Pancreatic Cancer
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Tissue and serum markers of inflammation during the follow-up of patients with giant-cell arteritis--a prospective longitudinal study
Gill N, Leng Y, Romero R, Xu Y, Panaitescu B, Miller D, Arif A, Mumuni S, Qureshi F, Hsu C, Hassan S, Staff A, Gomez‐Lopez N
American Journal of Reproductive Immunology 2019;81(4)
American Journal of Reproductive Immunology 2019;81(4)
IL35 Hinders Endogenous Antitumor T-cell Immunity and Responsiveness to Immunotherapy in Pancreatic Cancer
Mirlekar B, Michaud D, Searcy R, Greene K, Pylayeva-Gupta Y
Cancer Immunology Research 2018;6(9):1014-1024
Cancer Immunology Research 2018;6(9):1014-1024
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model
Kato B, Nicholson G, Neiman M, Rantalainen M, Holmes C, Barrett A, Uhlén M, Nilsson P, Spector T, Schwenk J
Proteome Science 2011;9(1):73
Proteome Science 2011;9(1):73
Tissue and serum markers of inflammation during the follow-up of patients with giant-cell arteritis--a prospective longitudinal study
Visvanathan S, Rahman M, Hoffman G, Xu S, Garcia-Martinez A, Segarra M, Lozano E, Espigol-Frigole G, Hernandez-Rodriguez J, Cid M
Rheumatology 2011;50(11):2061-2070
Rheumatology 2011;50(11):2061-2070
No comments: Submit comment
No validations: Submit validation data