Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001886 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001886, RRID:AB_1079132
- Product name
- Anti-IL12A
- Antibody type
- Polyclonal
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLH
HSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDI
TKDKTSTVEACLPLELTKNESCLNSRETSFITNGS
CLASRKTSFMMALCLSSIYEDLKMYQVEF- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tissue and serum markers of inflammation during the follow-up of patients with giant-cell arteritis--a prospective longitudinal study
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Visvanathan S, Rahman M, Hoffman G, Xu S, Garcia-Martinez A, Segarra M, Lozano E, Espigol-Frigole G, Hernandez-Rodriguez J, Cid M
Rheumatology 2011 October;50(11):2061-2070
Rheumatology 2011 October;50(11):2061-2070
Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model.
Kato BS, Nicholson G, Neiman M, Rantalainen M, Holmes CC, Barrett A, Uhlén M, Nilsson P, Spector TD, Schwenk JM
Proteome science 2011 Nov 17;9:73
Proteome science 2011 Nov 17;9:73
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows moderate cytoplasmic positivity in germinal and non-germinal center cells.