HPA001886

IL12A antibody from Sigma-Aldrich
CLMF, IL-12A, NFSK, NKSF1, p35
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001886
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001886, RRID:AB_1079132
Product name
Anti-IL12A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001886
Antibody type
Polyclonal
Antigen
Interleukin-12 subunit alpha precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLH
HSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDI
TKDKTSTVEACLPLELTKNESCLNSRETSFITNGS
CLASRKTSFMMALCLSSIYEDLKMYQVEF
Storage
-20C
Provider Type Product Number
- No reagents -