HPA001888

LRG1 antibody from Atlas Antibodies
LRG
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001888
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001888, RRID:AB_1079276
Product name
Anti-LRG1
Provider product page
Atlas Antibodies - HPA001888
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTV
HLAVEFFNLTHLPANLLQGASKLQELHLSSNGLES
LSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASAT
LDTLVLKENQLEVLEVSWLHGLKALGHLDLSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -