Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA001888 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA001888, RRID:AB_1079276
- Product name
- Anti-LRG1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTV
HLAVEFFNLTHLPANLLQGASKLQELHLSSNGLES
LSPEFLRPVPQLRVLDLTRNALTGLPPGLFQASAT
LDTLVLKENQLEVLEVSWLHGLKALGHLDLSG- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references LRG1 promotes angiogenesis by modulating endothelial TGF-β signalling.
Tumour expression of bladder cancer-associated urinary proteins
Wang X, Abraham S, McKenzie JAG, Jeffs N, Swire M, Tripathi VB, Luhmann UFO, Lange CAK, Zhai Z, Arthur HM, Bainbridge J, Moss SE, Greenwood J
Nature 2013 Jul 18;499(7458):306-11
Nature 2013 Jul 18;499(7458):306-11
Tumour expression of bladder cancer-associated urinary proteins
Lindén M, Segersten U, Runeson M, Wester K, Busch C, Pettersson U, Lind S, Malmström P
BJU International 2013 August;112(3):407-415
BJU International 2013 August;112(3):407-415
No comments: Submit comment
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human liver and cerebral cortex tissues using HPA001888 antibody. Corresponding LRG1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows low expression as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate positivity in plasma.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human colon shows weak to moderate positivity in plasma.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows very weak cytoplasmic positivity in a subset of neurons.
- Sample type
- HUMAN