HPA001889

LRG1 antibody from Sigma-Aldrich
LRG
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001889
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001889, RRID:AB_1079275
Product name
Anti-LRG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001889
Antibody type
Polyclonal
Antigen
Leucine-rich alpha-2-glycoprotein precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVL
GKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQL
DMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDIS
GNPWICDQNLSDLYRWLQAQKDKMFSQND
Storage
-20C
Provider Type Product Number
- No reagents -