Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010982-M03 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010982-M03, RRID:AB_565930
- Product name
- MAPRE2 monoclonal antibody (M03), clone 4D7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MAPRE2.
- Antigen sequence
MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVR
GERSYSWGMAVNVYSTSITQETMSRHD- Isotype
- IgG
- Antibody clone number
- 4D7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- MAPRE2 monoclonal antibody (M03), clone 4D7 Western Blot analysis of MAPRE2 expression in K-562 ( Cat # L009V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MAPRE2 expression in transfected 293T cell line by MAPRE2 monoclonal antibody (M03), clone 4D7.Lane 1: MAPRE2 transfected lysate (Predicted MW: 37 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to MAPRE2 on HeLa cell. [antibody concentration 35 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to MAPRE2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol