Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109615 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger and SCAN Domain Containing 20 (ZSCAN20) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZSCAN20 antibody: synthetic peptide directed towards the middle region of human ZSCAN20
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Antigen sequence
QESSSEEDLEKLIDHQGLYLAEKPYKCDTCMKSFS
RSSHFIAHQRIHTGE- Epitope
- Middle Region
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Disrupted function and axonal distribution of mutant tyrosyl-tRNA synthetase in dominant intermediate Charcot-Marie-Tooth neuropathy.
Jordanova A, Irobi J, Thomas FP, Van Dijck P, Meerschaert K, Dewil M, Dierick I, Jacobs A, De Vriendt E, Guergueltcheva V, Rao CV, Tournev I, Gondim FA, D'Hooghe M, Van Gerwen V, Callaerts P, Van Den Bosch L, Timmermans JP, Robberecht W, Gettemans J, Thevelein JM, De Jonghe P, Kremensky I, Timmerman V
Nature genetics 2006 Feb;38(2):197-202
Nature genetics 2006 Feb;38(2):197-202
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HeLa; WB Suggested Anti-ZSCAN20 Antibody Titration: 0.2-1 ug/ml. Positive Control: Hela cell lysate; ZSCAN20 antibody - middle region (AP42215PU-N) in Human HeLa cells using Western Blot