HPA017933

ZSCAN20 antibody from Sigma-Aldrich
KOX29, ZNF31, ZNF360
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017933
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017933, RRID:AB_1859028
Product name
Anti-ZSCAN20 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017933
Antibody type
Polyclonal
Antigen
Zinc finger and SCAN domain-containing protein 20 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RSYRKAKSSHPPGTCPFYEELDSLMRARAAVRAMG
TVREAAGLPRCGQSSAETDAQEAWGEVANEDAVKP
STLCPKAPDMGFEMRHEDEDQISEQDIFEGLPGAL
SKCPTEAVCQPLDWGEDSENENEDEGQWG
Storage
-20C
Provider Type Product Number
- No reagents -