Antibody data

Product number
H00084307-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084307-M02, RRID:AB_1137552
Product name
ZNF397 monoclonal antibody (M02), clone 1F8
Provider product page
Abnova Corporation - H00084307-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF397.
Antigen sequence
EFDDPGQQVPASPQGPAVPWKDLTCLRASQESTDI
HLQPLKTQLKSWKPCLSPKSDCENSETATKEGISE
EKSQGLPQEPSFRGIKLSRPPKASSAIRWE
Isotype
IgG
Antibody clone number
1F8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -