HPA007289

ZNF397 antibody from Sigma-Aldrich
MGC13250, ZNF47, ZSCAN15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007289
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007289, RRID:AB_1079726
Product name
Anti-ZNF397OS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007289
Antibody type
Polyclonal
Antigen
Zinc finger protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QLPSQDRHFSLATFNRRIPTEHSVLESHESEGSFS
MNSNDITQQSVDTREKLYECFDCGKAFCQSSKLIR
HQRIHTGERPYACKECGKAFSLSSDLVRHQRIHSG
E
Storage
-20C
Provider Type Product Number
- No reagents -