HPA004732

CPN2 antibody from Atlas Antibodies
ACBP
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA004732
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA004732, RRID:AB_1078561
Product name
Anti-CPN2
Provider product page
Atlas Antibodies - HPA004732
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDTNYNLFNLALHGNPWQCDCHLAYLFNWLQQYTD
RLLNIQTYCAGPAYLKGQVVPALNEKQLVCPVTRD
HLGFQVTWPDESKAGGSWDLAVQERAARSQCTYSN
PEGTVVLACDQAQCRWLNVQLSPWQGSLGLQYNAS
QEW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -